Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor
LigandBDBM50230960
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1645058
Ki 0.030000±n/a nM
Citation Landagaray, EEttaoussi, MRami, MBoutin, JACaignard, DHDelagrange, PMelnyk, PBerthelot, PYous, S New quinolinic derivatives as melatonergic ligands: Synthesis and pharmacological evaluation. Eur J Med Chem127:621-631 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melatonin receptor
Name:Melatonin receptor
Synonyms:MTNR1B | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2)
Type:Enzyme
Mol. Mass.:40203.54
Organism:Homo sapiens (Human)
Description:P49286
Residue:362
Sequence:
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50230960
NameBDBM50230960
Synonyms:CHEMBL4089965
TypeSmall organic molecule
Emp. Form.C14H16N2O4S
Mol. Mass.308.353
SMILESCOc1ccc2cccc(CCC(=O)NS(C)(=O)=O)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a