Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstradiol 17-beta-dehydrogenase 1
LigandBDBM50232163
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1646098
IC50 0.500000±n/a nM
Citation Abdelsamie, ASvan Koppen, CJBey, ESalah, MBörger, CSiebenbürger, LLaschke, MWMenger, MDFrotscher, M Treatment of estrogen-dependent diseases: Design, synthesis and profiling of a selective 17ß-HSD1 inhibitor with sub-nanomolar IC Eur J Med Chem127:944-957 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Estradiol 17-beta-dehydrogenase 1
Name:Estradiol 17-beta-dehydrogenase 1
Synonyms:17-beta-HSD 1 | 17-beta-hydroxysteroid dehydrogenase type 1 | 20 alpha-hydroxysteroid dehydrogenase | 20-alpha-HSD | E2DH | Estradiol 17-beta-dehydrogenase 1 | Placental 17-beta-hydroxysteroid dehydrogenase
Type:Enzyme
Mol. Mass.:34945.13
Organism:Homo sapiens (Human)
Description:P14061
Residue:328
Sequence:
MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL
ETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTV
RMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVH
LSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV
FLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG
GAGPGAEDEAGRGAVGDPELGDPPAAPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50232163
NameBDBM50232163
Synonyms:CHEMBL4079675
TypeSmall organic molecule
Emp. Form.C18H10Cl2F2O3S
Mol. Mass.415.238
SMILESCOc1c(Cl)cc(cc1Cl)-c1ccc(s1)C(=O)c1c(F)ccc(O)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a