Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15)
LigandBDBM27566
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1646315
IC50 17600±n/a nM
Citation Thorsell, AGEkblad, TKarlberg, TLöw, MPinto, AFTrésaugues, LMoche, MCohen, MSSchüler, H Structural Basis for Potency and Promiscuity in Poly(ADP-ribose) Polymerase (PARP) and Tankyrase Inhibitors. J Med Chem60:1262-1271 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15)
Name:Human diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15)
Synonyms:(ARTD7 or PARP15) | (ARTD7 or PARP15, Y598L) | 2.4.2.30 | ADP-ribosyltransferase diphtheria toxin-like 7 | ARTD7 | B-aggressive lymphoma protein 3 | BAL3 | Human diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15, Y598L) | PARP-15 | PARP15 | Poly [ADP-ribose] polymerase 15
Type:n/a
Mol. Mass.:74595.89
Organism:Homo sapiens (Human)
Description:Q460N3
Residue:678
Sequence:
MAAPGPLPAAALSPGAPTPRELMHGVAGVTSRAGRDREAGSVLPAGNRGARKASRRSSSR
SMSRDNKFSKKDCLSIRNVVASIQTKEGLNLKLISGDVLYIWADVIVNSVPMNLQLGGGP
LSRAFLQKAGPMLQKELDDRRRETEEKVGNIFMTSGCNLDCKAVLHAVAPYWNNGAETSW
QIMANIIKKCLTTVEVLSFSSITFPMIGTGSLQFPKAVFAKLILSEVFEYSSSTRPITSP
LQEVHFLVYTNDDEGCQAFLDEFTNWSRINPNKARIPMAGDTQGVVGTVSKPCFTAYEMK
IGAITFQVATGDIATEQVDVIVNSTARTFNRKSGVSRAILEGAGQAVESECAVLAAQPHR
DFIITPGGCLKCKIIIHVPGGKDVRKTVTSVLEECEQRKYTSVSLPAIGTGNAGKNPITV
ADNIIDAIVDFSSQHSTPSLKTVKVVIFQPELLNIFYDSMKKRDLSASLNFQSTFSMTTC
NLPEHWTDMNHQLFCMVQLEPGQSEYNTIKDKFTRTCSSYAIEKIERIQNAFLWQSYQVK
KRQMDIKNDHKNNERLLFHGTDADSVPYVNQHGFNRSCAGKNAVSYGKGTYFAVDASYSA
KDTYSKPDSNGRKHMYVVRVLTGVFTKGRAGLVTPPPKNPHNPTDLFDSVTNNTRSPKLF
VVFFDNQAYPEYLITFTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM27566
NameBDBM27566
Synonyms:4-({3-[(4-cyclopropanecarbonylpiperazin-1-yl)carbonyl]-4-fluorophenyl}methyl)-1,2-dihydrophthalazin-1-one | Acylpiperazine analogue, 47 | Olaparib | US10174023, AZD2281 | US9187430, AZD-2281 | US9255106, AZD2281
TypeSmall organic molecule
Emp. Form.C24H23FN4O3
Mol. Mass.434.4628
SMILESFc1ccc(Cc2n[nH]c(=O)c3ccccc23)cc1C(=O)N1CCN(CC1)C(=O)C1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a