Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 1A
LigandBDBM50232898
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1649452
IC50 1500±n/a nM
Citation Borsari, CSantarem, NTorrado, JOlías, AICorral, MJBaptista, CGul, SWolf, MKuzikov, MEllinger, BWitt, GGribbon, PReinshagen, JLinciano, PTait, ACostantino, LFreitas-Junior, LHMoraes, CBBruno Dos Santos, PAlcântara, LMFranco, CHBertolacini, CDFontana, VTejera Nevado, PClos, JAlunda, JMCordeiro-da-Silva, AFerrari, SCosti, MP Methoxylated 2'-hydroxychalcones as antiparasitic hit compounds. Eur J Med Chem126:1129-1135 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 1A
Name:Cytochrome P450 1A
Synonyms:1.14.14.1 | CYP1A2 | CYPIA2 | Cholesterol 25-hydroxylase | Cytochrome P(3)450 | Cytochrome P450 1A2 | Cytochrome P450 4 | Cytochrome P450-P3
Type:PROTEIN
Mol. Mass.:58423.38
Organism:Homo sapiens (Human)
Description:ChEMBL_109705
Residue:516
Sequence:
MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKN
PHLALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDG
QSLTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELM
AGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFP
ILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGN
LIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLS
DRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL
WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLE
FSVPPGVKVDLTPIYGLTMKHARCEHVQARLRFSIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50232898
NameBDBM50232898
Synonyms:CHEMBL4071093
TypeSmall organic molecule
Emp. Form.C18H18O5
Mol. Mass.314.3325
SMILESCOc1cccc(\C=C\C(=O)c2cc(OC)c(OC)cc2O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a