Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytosolic phospholipase A2
LigandBDBM50233836
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1651523
IC50 49±n/a nM
Citation Arnsmann, MHanekamp, WElfringhoff, ASLehr, M Structure-activity relationship studies on 1-(2-oxopropyl)indole-5-carboxylic acids acting as inhibitors of cytosolic phospholipase A Eur J Med Chem125:1107-1114 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytosolic phospholipase A2
Name:Cytosolic phospholipase A2
Synonyms:Cytosolic phospholipase A2 | Lysophospholipase | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 | Phospholipase A2 group IVA | cPLA2
Type:Protein
Mol. Mass.:85219.30
Organism:Homo sapiens (Human)
Description:P47712
Residue:749
Sequence:
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEV
PFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYRAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50233836
NameBDBM50233836
Synonyms:CHEMBL4100466
TypeSmall organic molecule
Emp. Form.C33H43NO6
Mol. Mass.549.6976
SMILESCCCCCCCCc1ccc(OCC(=O)Cn2cc(C(=O)CCCCCOC)c3cc(ccc23)C(O)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a