Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPirin
LigandBDBM50234078
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1652024
Kd 44±n/a nM
Citation Cheeseman, MDChessum, NERye, CSPasqua, AETucker, MJWilding, BEvans, LELepri, SRichards, MSharp, SYAli, SRowlands, MO'Fee, LMiah, AHayes, AHenley, ATPowers, MTe Poele, RDe Billy, EPellegrino, LRaynaud, FBurke, Rvan Montfort, RLEccles, SAWorkman, PJones, K Discovery of a Chemical Probe Bisamide (CCT251236): An Orally Bioavailable Efficacious Pirin Ligand from a Heat Shock Transcription Factor 1 (HSF1) Phenotypic Screen. J Med Chem60:180-201 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pirin
Name:Pirin
Synonyms:PIR | Probable quercetin 2,3-dioxygenase PIR | Probable quercetinase
Type:PROTEIN
Mol. Mass.:32115.50
Organism:Homo sapiens (Human)
Description:ChEMBL_811273
Residue:290
Sequence:
MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRG
FETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNL
RSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGA
KHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVL
IAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50234078
NameBDBM50234078
Synonyms:CHEMBL4087666
TypeSmall organic molecule
Emp. Form.C32H32N4O5
Mol. Mass.552.6203
SMILESCc1ccc(NC(=O)c2ccc3OCCOc3c2)cc1NC(=O)c1ccc2nc(OCCN3CCCC3)ccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a