Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 9
LigandBDBM50234925
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1654193
IC50 1259±n/a nM
Citation Humphreys, PGBamborough, PChung, CWCraggs, PDGordon, LGrandi, PHayhow, TGHussain, JJones, KLLindon, MMichon, AMRenaux, JFSuckling, CJTough, DFPrinjha, RK Discovery of a Potent, Cell Penetrant, and Selective p300/CBP-Associated Factor (PCAF)/General Control Nonderepressible 5 (GCN5) Bromodomain Chemical Probe. J Med Chem60:695-709 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 9
Name:Bromodomain-containing protein 9
Synonyms:BRD9 | Bromodomain-containing protein 9 | Rhabdomyosarcoma antigen MU-RMS-40.8
Type:PROTEIN
Mol. Mass.:66994.30
Organism:Homo sapiens (Human)
Description:ChEMBL_108000
Residue:597
Sequence:
MGKKHKKHKAEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHER
ERHKEKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREREHCDTEGEADDFDPGKKVEVEP
PPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHP
MDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQ
AALLGNEDTAVEEPVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVL
ALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLS
SKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQ
CALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLG
DSSSSVLEFMSMKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAE
RGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQSPEPAASAKT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50234925
NameBDBM50234925
Synonyms:CHEMBL4096572
TypeSmall organic molecule
Emp. Form.C12H12ClN3O
Mol. Mass.249.696
SMILESCc1cccc(Nc2cnn(C)c(=O)c2Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a