Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone acetyltransferase KAT2A/KAT2B
LigandBDBM50234942
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1654185
IC50 19953±n/a nM
Citation Humphreys, PGBamborough, PChung, CWCraggs, PDGordon, LGrandi, PHayhow, TGHussain, JJones, KLLindon, MMichon, AMRenaux, JFSuckling, CJTough, DFPrinjha, RK Discovery of a Potent, Cell Penetrant, and Selective p300/CBP-Associated Factor (PCAF)/General Control Nonderepressible 5 (GCN5) Bromodomain Chemical Probe. J Med Chem60:695-709 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone acetyltransferase KAT2A/KAT2B
Name:Histone acetyltransferase KAT2A/KAT2B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:93045.76
Organism:Homo sapiens (Human)
Description:ChEMBL_1502838
Residue:832
Sequence:
MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAA
AGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTP
PRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEED
ADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKE
RQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR
YETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQ
NSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSG
LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSA
RDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD
PKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
DILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFS
VIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSK
EPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNR
YYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50234942
NameBDBM50234942
Synonyms:CHEMBL4093233
TypeSmall organic molecule
Emp. Form.C6H8ClN3O
Mol. Mass.173.6
SMILESCNc1cnn(C)c(=O)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a