Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSRSF protein kinase 1
LigandBDBM50235034
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1654400
Ki 890±n/a nM
Citation Shi, YPark, JLagisetti, CZhou, WSambucetti, LCWebb, TR A triple exon-skipping luciferase reporter assay identifies a new CLK inhibitor pharmacophore. Bioorg Med Chem Lett27:406-412 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SRSF protein kinase 1
Name:SRSF protein kinase 1
Synonyms:2.7.11.1 | SFRS protein kinase 1 | SR-protein-specific kinase 1 | SRSF protein kinase 1 | Serine/arginine-rich protein-specific kinase 1 | Srpk1
Type:PROTEIN
Mol. Mass.:73082.57
Organism:Mus musculus
Description:ChEMBL_117355
Residue:648
Sequence:
MERKVLALQARKKRTKAKKDKAQRKPETQHRGSAPHSESDIPEQEEEILGSDDDEQEDPN
DYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTET
ALDEIRLLKSVRNSDPNDPNGEMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSN
YQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQR
SGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQ
KRPNKQEESESPVDRPLTENPPNKMTQEKLEESNSIGQDQTLTERGGEGGAPEINCNGVI
GVVNYPENSNNETLRHKEDLHNANDCDVHTLKQEPSFLNSSNGDSSPSQDTDSCTPTASE
TMVCQSSAEQSLTRQDITQLEESIRADTPSGDEQEPNGALDSKGKFSAGNFLINPLEPKN
AEKLQVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATG
DYLFEPHSGEDYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWG
LLEVLVEKYEWPQEEAAGFTDFLLPMLELMPEKRATAAECLRHPWLNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50235034
NameBDBM50235034
Synonyms:CHEMBL4064277
TypeSmall organic molecule
Emp. Form.C18H18F3N3O
Mol. Mass.349.3502
SMILESFC(F)(F)c1ccc(N2CCCCC2)c(NC(=O)c2ccncc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a