Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMineralocorticoid receptor
LigandBDBM50235933
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1658437
Ki 12±n/a nM
Citation Martín-Martínez, MPérez-Gordillo, FLÁlvarez de la Rosa, DRodríguez, YGerona-Navarro, GGonzález-Muñiz, RZhou, MM Modulating Mineralocorticoid Receptor with Non-steroidal Antagonists. New Opportunities for the Development of Potent and Selective Ligands without Off-Target Side Effects. J Med Chem60:2629-2650 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mineralocorticoid receptor
Name:Mineralocorticoid receptor
Synonyms:MCR | MLR | MR | NR3C2 | Nuclear receptor subfamily 3 group C member 2
Type:Enzyme
Mol. Mass.:107076.42
Organism:Homo sapiens (Human)
Description:P08235
Residue:984
Sequence:
METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSATVAESMGLYMDSVRDADYSYE
QQNQQGSMSPAKIYQNVEQLVKFYKGNGHRPSTLSCVNTPLRSFMSDSGSSVNGGVMRAV
VKSPIMCHEKSPSVCSPLNMTSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPN
VENRGSRSHSPAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSP
ANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSAGSSTLRDVVP
SPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNSKINSD
SSFSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSAR
DQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVN
TALVPQLSTISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQV
VKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKM
HQSAMYELCQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYI
KELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAML
VEIISDQLPKVESGNAKPLYFHRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50235933
NameBDBM50235933
Synonyms:CHEMBL3775714
TypeSmall organic molecule
Emp. Form.C22H15FN2O2
Mol. Mass.358.3651
SMILESFc1ccc2c(OCc3ccccc3\C2=C/c2ccc3[nH]c(=O)[nH]c3c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a