Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetdCTP pyrophosphatase 1
LigandBDBM50236117
Substrate/Competitorn/a
Meas. Tech.ChEBML_1658761
IC50 271±n/a nM
Citation Llona-Minguez, SHöglund, AWiita, EAlmlöf, IMateus, ACalderón-Montaño, JMCazares-Körner, CHoman, ELoseva, OBaranczewski, PJemth, ASHäggblad, MMartens, ULundgren, BArtursson, PLundbäck, TJenmalm Jensen, AWarpman Berglund, UScobie, MHelleday, T Identification of Triazolothiadiazoles as Potent Inhibitors of the dCTP Pyrophosphatase 1. J Med Chem60:2148-2154 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
dCTP pyrophosphatase 1
Name:dCTP pyrophosphatase 1
Synonyms:Deoxycytidine-triphosphatase 1
Type:Protein
Mol. Mass.:18673.58
Organism:Homo sapiens (Human)
Description:Q9H773
Residue:170
Sequence:
MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLAL
VGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLS
KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236117
NameBDBM50236117
Synonyms:CHEMBL4083779
TypeSmall organic molecule
Emp. Form.C14H8ClN5S
Mol. Mass.313.765
SMILESClc1cccc(c1)-c1nn2c(nnc2s1)-c1ccccn1
Structure
n/a