Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADP-sugar pyrophosphatase
LigandBDBM50236118
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1658775
IC50>100000±n/a nM
Citation Llona-Minguez, SHöglund, AWiita, EAlmlöf, IMateus, ACalderón-Montaño, JMCazares-Körner, CHoman, ELoseva, OBaranczewski, PJemth, ASHäggblad, MMartens, ULundgren, BArtursson, PLundbäck, TJenmalm Jensen, AWarpman Berglund, UScobie, MHelleday, T Identification of Triazolothiadiazoles as Potent Inhibitors of the dCTP Pyrophosphatase 1. J Med Chem60:2148-2154 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
ADP-sugar pyrophosphatase
Name:ADP-sugar pyrophosphatase
Synonyms:2.7.7.96 | 3.6.1.13 | 3.6.1.58 | 8-oxo-dGDP phosphatase | ADP-sugar pyrophosphatase | NUDIX5 | NUDT5 | Nuclear ATP-synthesis protein NUDIX5 | Nucleoside diphosphate-linked moiety X motif 5 | Nudix motif 5 | YSA1H | hNUDT5
Type:PROTEIN
Mol. Mass.:24317.26
Organism:Homo sapiens (Human)
Description:ChEMBL_117318
Residue:219
Sequence:
MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTAD
GVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYK
GDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQ
RLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236118
NameBDBM50236118
Synonyms:CHEMBL4065181
TypeSmall organic molecule
Emp. Form.C15H12N4O2S2
Mol. Mass.344.411
SMILESCOc1ccc(cc1OC)-c1nn2c(nnc2s1)-c1cccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a