Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific histone demethylase 1B
LigandBDBM50236441
Substrate/Competitorn/a
Meas. Tech.ChEBML_1659184
IC50 16600±n/a nM
Citation Vianello, PSartori, LAmigoni, FCappa, AFagá, GFattori, RLegnaghi, ECiossani, GMattevi, AMeroni, GMoretti, LCecatiello, VPasqualato, SRomussi, AThaler, FTrifiró, PVilla, MBotrugno, OADessanti, PMinucci, SVultaggio, SZagarrí, EVarasi, MMercurio, C Thieno[3,2-b]pyrrole-5-carboxamides as New Reversible Inhibitors of Histone Lysine Demethylase KDM1A/LSD1. Part 2: Structure-Based Drug Design and Structure-Activity Relationship. J Med Chem60:1693-1715 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific histone demethylase 1B
Name:Lysine-specific histone demethylase 1B
Synonyms:Flavin-containing amine oxidase domain-containing protein 1 | Lysine-specific histone demethylase 2
Type:PROTEIN
Mol. Mass.:92112.91
Organism:Homo sapiens (Human)
Description:ChEMBL_992590
Residue:822
Sequence:
MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTA
TCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSN
GKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPE
TSDHCSLPEDLRVLEVSNHWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRA
AATGNASPGKLEHSKAALSVHVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEY
SRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKG
LINTGVLSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGR
VWDDKSFKGVTVGRGAQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTID
KRMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHL
SNLEYACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPVQC
IDYSGDEVQVTTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAINSLGAGIIE
KIALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVAS
VRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYD
IIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236441
NameBDBM50236441
Synonyms:CHEMBL4072541
TypeSmall organic molecule
Emp. Form.C28H31N3O4S
Mol. Mass.505.628
SMILESCOCc1cccc(NC(=O)c2cc3sccc3n2C)c1COc1ccc(OC[C@@H]2CCNC2)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a