Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrace amine-associated receptor 1 (TAAR1)
LigandBDBM29135
Substrate/Competitorn/a
Meas. Tech.ChEBML_1660341
EC50 69±n/a nM
Citation Glennon, RA The 2014 Philip S. Portoghese Medicinal Chemistry Lectureship: The"Phenylalkylaminome" with a Focus on Selected Drugs of Abuse. J Med Chem60:2605-2628 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trace amine-associated receptor 1 (TAAR1)
Name:Trace amine-associated receptor 1
Synonyms:Trace amine receptor 1 (TARR1) | Trace amine-associated receptor1
Type:Enzyme
Mol. Mass.:38034.73
Organism:Rattus norvegicus (Rat)
Description:Q923Y9
Residue:332
Sequence:
MHLCHNSANISHTNSNWSRDVRASLYSLISLIILTTLVGNLIVIISISHFKQLHTPTNWL
LHSMAVVDFLLGCLVMPYSMVRTVEHCWYFGELFCKLHTSTDIMLSSASILHLAFISIDR
YYAVCDPLRYKAKINLAAIFVMILISWSLPAVFAFGMIFLELNLEGVEELYHNQVFCLRG
CFPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRANLQVGLEGESRAPQ
SKETKAAKTLGIMVGVFLLCWCPFFFCMVLDPFLGYVIPPTLNDTLNWFGYLNSAFNPMV
YAFFYPWFRRALKMVLFGKIFQKDSSRSKLFL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29135
NameBDBM29135
Synonyms:CHEMBL11608 | cid_5610 | p-Tyramine | tyramine
TypeSmall organic molecule
Emp. Form.C8H11NO
Mol. Mass.137.179
SMILESNCCc1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a