Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde dehydrogenase X, mitochondrial
LigandBDBM50236909
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1659723
IC50 95±n/a nM
Citation Buchman, CDHurley, TD Inhibition of the Aldehyde Dehydrogenase 1/2 Family by Psoralen and Coumarin Derivatives. J Med Chem60:2439-2455 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde dehydrogenase X, mitochondrial
Name:Aldehyde dehydrogenase X, mitochondrial
Synonyms:ALDH1B1 | ALDH5 | ALDHX | Aldehyde dehydrogenase 5 | Aldehyde dehydrogenase family 1 member B1
Type:PROTEIN
Mol. Mass.:57207.14
Organism:Homo sapiens (Human)
Description:ChEMBL_109700
Residue:517
Sequence:
MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPT
TGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLA
SLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCG
QIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITG
YGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
EHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGP
QVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236909
NameBDBM50236909
Synonyms:CHEMBL4090473
TypeSmall organic molecule
Emp. Form.C17H16O3
Mol. Mass.268.3071
SMILESCc1oc2cc3oc(=O)c4CCCCc4c3cc2c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a