Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase 14
LigandBDBM50238242
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1663590
IC50 1600±n/a nM
Citation Durham, TBMarimuthu, JToth, JLLiu, CAdams, LMudra, DRSwearingen, CLin, CChambers, MGThirunavukkarasu, KWiley, MR A Highly Selective Hydantoin Inhibitor of Aggrecanase-1 and Aggrecanase-2 with a Low Projected Human Dose. J Med Chem60:5933-5939 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase 14
Name:Matrix metalloproteinase 14
Synonyms:MMP-14 | MMP-X1 | MT-MMP 1 | MT1-MMP | MT1MMP | MTMMP1 | Matrix Metalloproteinase-14 (MMP-14) | Matrix metalloproteinase 14 | Matrix metalloproteinase-14 | Membrane-type matrix metalloproteinase 1 | Membrane-type-1 matrix metalloproteinase
Type:Protein
Mol. Mass.:65900.19
Organism:Homo sapiens (Human)
Description:P50281
Residue:582
Sequence:
MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50238242
NameBDBM50238242
Synonyms:CHEMBL4094455
TypeSmall organic molecule
Emp. Form.C18H20F3N3O3
Mol. Mass.383.3649
SMILESC[C@@H](Cc1ccc(cc1)C(F)(F)F)C(=O)NC[C@]1(NC(=O)NC1=O)C1CC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a