Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcid ceramidase
LigandBDBM50238556
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1663372
IC50 0.900000±n/a nM
Citation Ortega, JAArencibia, JMLa Sala, GBorgogno, MBauer, IBono, LBraccia, CArmirotti, AGirotto, SGanesan, ADe Vivo, M Pharmacophore Identification and Scaffold Exploration to Discover Novel, Potent, and Chemically Stable Inhibitors of Acid Ceramidase in Melanoma Cells. J Med Chem60:5800-5815 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acid ceramidase
Name:Acid ceramidase
Synonyms:Acid ceramidase
Type:Enzyme
Mol. Mass.:44662.65
Organism:Homo sapiens (Human)
Description:Q13510
Residue:395
Sequence:
MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYK
RWHELMLDKAPVLKVIVNSLKNMINTFVPSGKIMQVVDEKLPGLLGNFPGPFEEEMKGIA
AVTDIPLGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITE
QLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWI
LGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKE
SLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLST
KPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50238556
NameBDBM50238556
Synonyms:CHEMBL4093029
TypeSmall organic molecule
Emp. Form.C18H20N4O
Mol. Mass.308.3776
SMILESNc1nc2ccccc2n1C(=O)NCCCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a