Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRB2
LigandBDBM82472
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_456
Citation Baxter, GS Novel discriminatory ligands for 5-HT2B receptors. Behav Brain Res73:149-52 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
ADRB2
Name:ADRB2
Synonyms:adrenergic Beta2
Type:Enzyme Catalytic Domain
Mol. Mass.:31639.06
Organism:RABBIT
Description:Q9BFY9
Residue:277
Sequence:
VLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGNFWCEFWTS
IDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQM
HWYRATHQEAINCYAKETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAKKQLQ
KIDKSEGRFHAQNLSQVEQDGRSGHGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPF
FIVNIVHVIRDNLIPKEVYILLNWVGYVNSAFNPLIY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82472
NameBDBM82472
Synonyms:BW-723C86 | CAS_5311036 | NSC_5311036
TypeSmall organic molecule
Emp. Form.C16H18N2OS
Mol. Mass.286.392
SMILESCC(N)Cc1c[nH]c2ccc(OCc3cccs3)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a