Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor 2a and 2c (5HT2A and 5HT2C)
LigandBDBM35256
Substrate/Competitorn/a
Ki 0.4±n/a nM
CommentsPDSP_1235
Citation Pälvimäki, EPRoth, BLMajasuo, HLaakso, AKuoppamäki, MSyvälahti, EHietala, J Interactions of selective serotonin reuptake inhibitors with the serotonin 5-HT2c receptor. Psychopharmacology (Berl)126:234-40 (1996) [PubMed]
More Info.:Get all data from this article
 
Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT2C | 5-hydroxytryptamine receptor 2C | 5-hydroxytryptamine receptor 2C (5HT2c) | HTR2C
Type:Enzyme
Mol. Mass.:51935.10
Organism:Rattus norvegicus (Rat)
Description:P08909
Residue:460
Sequence:
MVNLGNAVRSLLMHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS
IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV
WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW
AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY
VLRRQTLMLLRGHTEEELANMSLNFLNCCCKKNGGEEENAPNPNPDQKPRRKKKEKRPRG
TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGY
VCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRH
TNERVARKANDPEPGIEMQVENLELPVNPSNVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35256
NameBDBM35256
Synonyms:(S)-mianserin | Lerivon | MIANSERIN | MIANSERIN (+) | MIANSERIN (-) | Tolvon
TypeSmall organic molecule
Emp. Form.C18H20N2
Mol. Mass.264.3648
SMILES[H][C@]12CN(C)CCN1c1ccccc1Cc1ccccc21 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a