Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocyte-stimulating hormone receptor
LigandBDBM82407
Substrate/Competitorn/a
Ki 2.68±n/a nM
CommentsPDSP_2957
Citation Schiöth, HBMuceniece, RWikberg, JE Characterisation of the melanocortin 4 receptor by radioligand binding. Pharmacol Toxicol79:161-5 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
Melanocyte-stimulating hormone receptor
Name:Melanocortin receptor (M1 and M4)
Synonyms:MC1-R | MSH-R | Melanocortin MC1 | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R)
Type:Enzyme
Mol. Mass.:34717.23
Organism:Homo sapiens (Human)
Description:Q01726
Residue:317
Sequence:
MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82407
NameBDBM82407
Synonyms:Gamma1-MSH
TypeSmall organic molecule
Emp. Form.C72H97N21O14S
Mol. Mass.1512.738
SMILESCSCC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(C)C)C(=O)NCC(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |r,wU:64.66,86.90,42.43,8.8,wD:78.82,53.55,97.101,32.32,4.4,12.12,(-14.04,.99,;-14.78,2.35,;-14.02,3.65,;-14.77,4.99,;-14.01,6.33,;-14.73,7.71,;-16.25,7.73,;-17.05,6.43,;-17.03,9.09,;-18.55,9.11,;-19.31,10.42,;-18.57,11.8,;-20.87,10.42,;-21.61,11.75,;-21.65,9.02,;-20.87,7.69,;-21.61,6.34,;-20.83,5.03,;-19.26,5.05,;-18.53,3.73,;-18.55,6.43,;-19.33,7.69,;-16.24,10.4,;-17.01,11.75,;-14.7,10.37,;-12.42,6.34,;-11.64,7.66,;-11.62,5.05,;-10.08,5.12,;-9.32,3.78,;-10.05,2.47,;-7.8,3.75,;-7.06,2.38,;-7.8,1.04,;-7.06,-.28,;-5.54,-.43,;-5.12,-1.9,;-6.42,-2.71,;-7.65,-1.76,;-5.47,2.4,;-4.71,3.73,;-4.67,1.11,;-3.12,1.18,;-2.36,2.54,;-.86,2.59,;-.16,3.96,;1.39,3.98,;2.27,2.71,;1.55,1.33,;-.01,1.31,;-2.31,-.1,;-3.02,-1.45,;-.79,-.03,;.06,-1.28,;-.63,-2.68,;.27,-3.99,;-.44,-5.36,;.51,-6.64,;-.15,-7.98,;.77,-9.26,;-1.62,-8.21,;1.63,-1.23,;2.31,.16,;2.5,-2.47,;3.95,-2.35,;4.73,-.92,;6.14,-.69,;7.25,-1.9,;8.72,-1.33,;8.53,.26,;9.57,1.37,;9.12,2.85,;7.6,3.13,;6.56,2.06,;7.01,.55,;4.9,-3.56,;4.09,-5.13,;6.39,-3.25,;7.42,-4.37,;6.97,-5.86,;8.03,-6.98,;9.51,-6.64,;7.53,-8.52,;8.96,-4.04,;9.41,-2.59,;10,-5.13,;11.45,-4.77,;11.9,-3.27,;13.45,-2.92,;13.89,-1.45,;15.42,-1.18,;15.91,.29,;17.43,.59,;14.96,1.43,;12.56,-5.88,;12.12,-7.38,;14.04,-5.51,;15.11,-6.64,;14.7,-8.12,;15.75,-9.23,;17.27,-8.9,;18.36,-10.04,;17.91,-11.48,;16.39,-11.8,;15.32,-10.7,;16.6,-6.26,;17.64,-7.34,;17.03,-4.8,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a