Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM10755
Substrate/Competitorn/a
Ki 2.3±n/a nM
CommentsPDSP_150
Citation Schotte, AJanssen, PFGommeren, WLuyten, WHVan Gompel, PLesage, ASDe Loore, KLeysen, JE Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl)124:57-73 (1996) [PubMed]  Article
More Info.:Get all data from this article
 
Serotonin (5-HT) receptor
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1E | 5-HT1E | 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E) | 5-hydroxytryptamine receptor 1E | 5-hydroxytryptamine receptor 1E (5-HT-1E) (S31) | 5-hydroxytryptamine receptor 1E (5-HT-1E) (Serotonin receptor 1E) (5-HT1E) (S31). | S31 | Serotonin 1e (5-HT1e) receptor | Serotonin Receptor 1E
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41697.80
Organism:Homo sapiens (Human)
Description:gi_112822
Residue:365
Sequence:
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ
TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10755
NameBDBM10755
Synonyms:14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT
TypeSmall organic molecule
Emp. Form.C10H12N2O
Mol. Mass.176.2151
SMILESNCCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a