Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGRM7
LigandBDBM17664
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_3212
Citation Conn, PJPin, JP Pharmacology and functions of metabotropic glutamate receptors. Annu Rev Pharmacol Toxicol37:205-37 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
GRM7
Name:Metabotropic glutamate receptor 7
Synonyms:GRM7 protein | Metabotropic glutamate receptor 7 | metabotropic glutamate 7
Type:Enzyme Catalytic Domain
Mol. Mass.:102262.98
Organism:Homo sapiens (Human)
Description:Q14831
Residue:915
Sequence:
MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
TFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
ISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRR
NVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH
ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIF
QYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTP
CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAML
GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
FGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
PAAKKKYVSYNNLVI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17664
NameBDBM17664
Synonyms:(2S)-2-amino-3-(phosphonooxy)propanoic acid | CHEMBL284377 | L-SOP | L-serine O-phosphate
TypeSmall organic molecule
Emp. Form.C3H8NO6P
Mol. Mass.185.0725
SMILESN[C@@H](COP(O)(O)=O)C(O)=O
Structure
n/a