Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR2A
LigandBDBM82369
Substrate/Competitorn/a
Ki 1820±n/a nM
CommentsPDSP_1953
Citation Mos, JVan Hest, AVan Drimmelen, MHerremans, AHOlivier, B The putative 5-HT1A receptor antagonist DU125530 blocks the discriminative stimulus of the 5-HT1A receptor agonist flesinoxan in pigeons. Eur J Pharmacol325:145-53 (1997) [PubMed]
More Info.:Get all data from this article
 
HTR2A
Name:HTR2A
Synonyms:5-HT2A
Type:Enzyme Catalytic Domain
Mol. Mass.:105583.25
Organism:pigeon
Description:5-HT2A HTR2A pigeon::A0A1V4J4E5
Residue:946
Sequence:
MGVFVKDSSDSAYLTPERKLALGRGKAQGKSRQAAYLSEEKNKPRSTGTGFTQVCSLEVK
KLFQIPPFWRRLKKRDAKLAKHNEEYSESVQSEPNRILRVGSDVQPGFSMYAYTGLPMEL
KTKHFSIQSNSVSNFAMDILCDQESSVNPTAKSLIQINHERRLYRNVYGAGEINASHLFN
LTVDSENLTNVSSESSVTPPCYSSLFQLSQKNWPALLTVIVIVLTIAGNILVIMAVSLEK
KLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYAWPLPRKLCAIWIYLDVLFSTASI
MHLCAISLDRYIAIRNPIHHSRFNSRTKAFAKIIAVWTISVGISMPVPVFGLQDDSKVFK
KDSCLLADDNFVLVGSFVAFFIPLTIMVVTYFLTIKSLQKEAMLCVNDIGPKTKFASFSF
LPQSSLSSEKLFQRSLNRDVGTSGRRTMQSISNEQKASKVLGIVFFLFVVMWCPFFITNV
MAVICKESCNQEVIGELLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCRYKEEKK
PFQLILVNTIPALAYNSSQLQLAQMKSLKKEAKMMAKDYSMVTIGIHHLDGTSKGSISPV
NENVSETAAQHPPWQTQTGRLRALPRSAGGPGRQAGRLEAAPARGQPPPPVLRRAAPPLL
LVKAMALKQVSSNKCFEGFQKVFEHDSAELKCKMKFGIYLPPKAETGKCPVLYWLSGLTC
TEQNFITKAGFHQAAAEHGLIVVAPDTSPRGCNIEGEDESWDFGTGAGFYVDATEDPWKT
NYRMYSYIKDELPKLINANFPTDPERMSIFGHSMGGHGALILALKNPGKYKSVSAFAPIC
NPMQCQWGKKALGGYLGSDASKWEAYDATQLVKSYPDSHLDILIDQGKDDQFLSAGQLLP
DNFIAACTERKIPVVFRLQQGYDHSYFFIATFINDHIKHHAKYLNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82369
NameBDBM82369
Synonyms:CAS_133025-23-7 | WAY 100,135 | WAY 100135
TypeSmall organic molecule
Emp. Form.C24H33N3O2
Mol. Mass.395.5377
SMILESCOc1ccccc1N1CCN(C[C@@H](C(=O)NC(C)(C)C)c2ccccc2)CC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a