Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50001888
Substrate/Competitorn/a
Ki 0.84±n/a nM
CommentsPDSP_513
Citation Seeman, PTallerico, T Antipsychotic drugs which elicit little or no parkinsonism bind more loosely than dopamine to brain D2 receptors, yet occupy high levels of these receptors. Mol Psychiatry3:123-34 (1998) [PubMed]
More Info.:Get all data from this article
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001888
NameBDBM50001888
Synonyms:(chloropromazine) [3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine | (chlorpromazine)[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine | 1-(2-Allyl-phenoxy)-3-isopropylamino-propan-2-ol | 1N,1N-dimethyl-3-(2-chloro-10H-10-phenothiazinyl)-1-propanamine | 3-(2-chloro-10H-phenothiazin-10-yl)-N,N-dimethylpropan-1-amine | CHEMBL71 | CHLORPROMAZINE | CHLORPROMAZINE HIBENZATE | CHLORPROMAZINE HYDROCHLORIDE | CHLORPROMAZINE PHENOLPHTHALINATE | CHLORPROMAZINE TANNATE | Chlorpromazine;[3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine | PROMAPAR | SONAZINE | THORAZINE | [3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine (chlor-promazine) | [3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine( Chlorpromazine) | [3-(2-Chloro-phenothiazin-10-yl)-propyl]-dimethyl-amine(clorpromazine) | chloropromazine
TypeSmall organic molecule
Emp. Form.C17H19ClN2S
Mol. Mass.318.864
SMILESCN(C)CCCN1c2ccccc2Sc2ccc(Cl)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a