Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA2A
LigandBDBM84342
Substrate/Competitorn/a
Ki 389.05±n/a nM
CommentsPDSP_238
Citation Jasper, JRLesnick, JDChang, LKYamanishi, SSChang, TKHsu, SADaunt, DABonhaus, DWEglen, RM Ligand efficacy and potency at recombinant alpha2 adrenergic receptors: agonist-mediated [35S]GTPgammaS binding. Biochem Pharmacol55:1035-43 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
ADRA2A
Name:ADRA2A
Synonyms:Alpha-2A adrenergic receptor | adrenergic Alpha2A
Type:Enzyme Catalytic Domain
Mol. Mass.:48888.08
Organism:MOUSE
Description:adrenergic Alpha2A ADRA2A MOUSE::Q01338
Residue:450
Sequence:
MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGG
QQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACS
APPGGADRRPNGLGPERGAGPTGAEAEPLPTQLNGAPGEPAPAGPRDGDALDLEESSSSE
HAERPPGPRRPDRGPRAKGKTRASQVKPGDSLPRRGPGAAGPGASGSGHGEERGGGAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPSQLFNFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84342
NameBDBM84342
Synonyms:4-[1-hydroxy-2-(methylamino)ethyl]benzene-1,2-diol | 4-[1-hydroxy-2-(methylamino)ethyl]benzene-1,2-diol, 1 | 4-[1-hydroxy-2-(methylamino)ethyl]benzene-1,2-diol;hydrochloride | 4-[1-hydroxy-2-(methylamino)ethyl]pyrocatechol;hydrochloride | 4-[2-(methylamino)-1-oxidanyl-ethyl]benzene-1,2-diol;hydrochloride | DL-ADRENALINE HYDROCHLORIDE | EPINEPHRINE | EPINEPHRINE,(+) | MLS001333244 | SMR000058236 | cid_5924
TypeSmall organic molecule
Emp. Form.C9H13NO3
Mol. Mass.183.2044
SMILESCNCC(O)c1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a