Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMurE
LigandBDBM85278
Substrate/Competitorn/a
Meas. Tech.Enzymatic Assay
pH8±0
Temperature310.15±0 K
IC50 1.20e+5± 0 nM
Citation Sova, MKovac, ATurk, SHrast, MBlanot, DGobec, S Phosphorylated hydroxyethylamines as novel inhibitors of the bacterial cell wall biosynthesis enzymes MurC to MurF. Bioorg Chem37:217-22 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MurE
Name:MurE
Synonyms:MurE (S. aureus) | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L-lysine ligase
Type:Protein
Mol. Mass.:54095.36
Organism:Staphylococcus aureus
Description:Q2FZP6
Residue:493
Sequence:
MDASTLFKKVKVKRVLGSLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQG
CKLVVVNKEQSLPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATM
IHLIQRKLQKNSAYLGTNGFQINETKTKGANTTPETVSLTKKIKEAVDAGAESMTLEVSS
HGLVLGRLRGVEFDVAIFSNLTQDHLDFHGTMEAYGHAKSLLFSQLGEDLSKEKYVVLNN
DDSFSEYLRTVTPYEVFSYGIDEEAQFMAKNIQESLQGVSFDFVTPFGTYPVKSPYVGKF
NISNIMAAMIAVWSKGTSLETIIKAVENLEPVEGRLEVLDPSLPIDLIIDYAHTADGMNK
LIDAVQPFVKQKLIFLVGMAGERDLTKTPEMGRVACRADYVIFTPDNPANDDPKMLTAEL
AKGATHQNYIEFDDRAEGIKHAIDIAEPGDTVVLASKGREPYQIMPGHIKVPHRDDLIGL
EAAYKKFGGGPVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85278
n/a
NameBDBM85278
Synonyms:HEA derivative, 7e
TypeSmall organic molecule
Emp. Form.C14H23N2O7PS
Mol. Mass.394.38
SMILESCc1ccc(cc1)S(=O)(=O)NCC(CN1CCOCC1)OP(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: