Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCollagenase
LigandBDBM85281
Substrate/Competitorn/a
Meas. Tech.Fluorimetric Assay
pH7±0
Temperature298.15±0 K
IC50 4.5e+4± 0 nM
Citation Panico, AMVicini, PGeronikaki, AIncerti, MCardile, VCrascì, LMessina, RRonsisvalle, S Heteroarylimino-4-thiazolidinones as inhibitors of cartilage degradation. Bioorg Chem39:48-52 (2011) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Collagenase
Name:Matrix metalloproteinase (1 and 13)
Synonyms:Collagenase 3 | MMP-13 | Matrix metalloproteinase-13 | Matrix metalloproteinase-13 (MMP-13) | Matrix metalloproteinase-13 (MMP13)
Type:Enzyme
Mol. Mass.:53808.06
Organism:Homo sapiens (human)
Description:n/a
Residue:471
Sequence:
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA
ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY
RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG
PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM
FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY
DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85281
NameBDBM85281
Synonyms:2-(benzo[d]-thiazol-2-ylimino)-5-benzylidenethiazolidin-4-one, 2a
TypeSmall organic molecule
Emp. Form.C17H11N3OS2
Mol. Mass.337.419
SMILESO=C1N\C(S\C1=C\c1ccccc1)=N/c1nc2ccccc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a