Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-catenin-interacting protein 1
LigandBDBM269262
Substrate/Competitorn/a
Meas. Tech.Idiopathic Pulmonary Fibrosis (IPF) Primary Screening Assay
IC50 247±n/a nM
Citation Hood, JKC, SKWallace, DM 1H-pyrazolo[3,4-b]pyridines and therapeutic uses thereof US Patent US10071086 Publication Date 9/11/2018
More Info.:Get all data from this article,  Assay Method
 
Beta-catenin-interacting protein 1
Name:Beta-catenin-interacting protein 1
Synonyms:CTNNBIP1 | ICAT | Inhibitor of beta-catenin and Tcf-4
Type:Enzyme Catalytic Domain
Mol. Mass.:9168.75
Organism:n/a
Description:n/a
Residue:81
Sequence:
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI
DQGAEDVVMAFSRSETEDRRQ
 
BDBM269262
NameBDBM269262
Synonyms:US10071086, Compound 10
TypeSmall organic molecule
Emp. Form.C29H26FN9
Mol. Mass.519.5754
SMILESCN1CCN(Cc2cc(F)cc(c2)-c2cncc3[nH]c(nc23)-c2n[nH]c3ncc(cc23)-c2cccnc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a