Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHomo sapiens lysine demethylase 2A (KDM2A)
LigandBDBM276086
Substrate/Competitorn/a
Meas. Tech.FBXL11 Assay
Temperature298.15±n/a K
IC50<100±n/a nM
Commentsextracted
Citation Chen, YKNie, ZStafford, JAVeal, JM Histone demethylase inhibitors US Patent US10071984 Publication Date 9/11/2018
More Info.:Get all data from this article,  Assay Method
 
Homo sapiens lysine demethylase 2A (KDM2A)
Name:Homo sapiens lysine demethylase 2A (KDM2A)
Synonyms:AA1-1162 | F-box and leucine-rich repeat protein 11 | FBXL11 | Lysine-specific demethylase 2A | Lysine-specific demethylase 2A (KDM2A) | NM_012308
Type:Enzyme Catalytic Domain
Mol. Mass.:132809.04
Organism:Homo sapiens (Human)
Description:n/a
Residue:1162
Sequence:
MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGK
DFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIE
MTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTVDFIDWVDNMWPRHLKES
QTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHN
LELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFL
HSFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKEFQKESLS
MDLELNGLESGNGDEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKT
LAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPT
GIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKP
HTMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRM
KQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEG
LLNEELPNCWECPKCYQEDSSEKAQKRKMEESDEEAVQAKVLRPLRSCDEPLTPPPHSPT
SMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNP
SGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRHSPRVLVQHC
PARTPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMS
VFRYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLS
WTNISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIR
DLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQ
SSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHF
ISDLSINSLYCLSDEKLIQKIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM276086
NameBDBM276086
Synonyms:1-[(3,4-dichlorophenyl)methyl]-4-{1H-[1,2,3]triazolo[4,5-c]pyridin-6-yl}-1H-imidazole | US10071984, Example 48 | US10174003, Example 48
TypeSmall organic molecule
Emp. Form.C15H10Cl2N6
Mol. Mass.345.186
SMILESClc1ccc(Cn2cnc(c2)-c2cc3[nH]nnc3cn2)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a