Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCNR1
LigandBDBM21244
Substrate/Competitorn/a
Ki 3.8±n/a nM
CommentsPDSP_572
Citation Soderstrom, KLeid, MMoore, FLMurray, TF Behaviroal, pharmacological, and molecular characterization of an amphibian cannabinoid receptor. J Neurochem75:413-23 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
CNR1
Name:CNR1
Synonyms:CANNABINOID CB1
Type:Enzyme Catalytic Domain
Mol. Mass.:53332.86
Organism:Newt
Description:CANNABINOID CB1 CNR1 Newt::Q9PUI7
Residue:473
Sequence:
MKSILDGLADTTFRTITTDLLYMGSNDVQYEDTKGEMASKLGYFPQKLPLSSFRRDHSPD
KMTIGDDNLLSFYPLDQFNVTEFFNRSVSTFKENDDNLKCGENFMDMECFMILTASQQLI
IAVLSLTLGTFTVLENFLVLCVILQSRTLRCRPSYHFIGSLAVADLLGSVIFVYSFLDFH
VFHRKDSSNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRTKAVIAFC
VMWTIAIIIAVLPLLGWNCKKLKSVCSDIFPLIDENYLMFWIGVTSILLLFIVYAYVYIL
WKAHSHAVRMLQRGTQKSIIIHTSEDGKVQITRPEQTRMDIRLAKTLVLILVVLIICWGP
LLAIMVYDVFGKMNNPIKTVFAFCSMLCLMDSTVNPIIYALRSQDLRHAFLEQCPPCEGT
SQPLDNSMESDCQHRHGNNAGNVHRAAENCIKSTVKIAKVTMSVSTETSGEAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21244
NameBDBM21244
Synonyms:2-[(1S,2S,5S)-5-hydroxy-2-(3-hydroxypropyl)cyclohexyl]-5-(2-methyloctan-2-yl)phenol | 3-(2-hydroxy-4-(1,1-dimethylheptyl)phenyl)-4-(3-hydroxypropyl)cyclohexanol | CP 55,940 | CP-55,940 | CP-56667 [(+)-AC],XV | [3H]-56 | [3H]CP55940
Typeradiolabeled ligand
Emp. Form.C24H40O3
Mol. Mass.376.5726
SMILESCCCCCCC(C)(C)c1ccc([C@H]2C[C@@H](O)CC[C@@H]2CCCO)c(O)c1
Structure
n/a