Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNociceptin receptor
LigandBDBM50087016
Substrate/Competitorn/a
Ki 2.51±n/a nM
CommentsPDSP_2072
Citation Hashiba, EHarrison, CGalo', GGuerrini, RRowbotham, DJSmith, GLambert, DG Characterisation and comparison of novel ligands for the nociceptin/orphanin FQ receptor. Naunyn Schmiedebergs Arch Pharmacol363:28-33 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
Nociceptin receptor
Name:Nociceptin receptor
Synonyms:KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OPIATE ORL-1 | OPRL1 protein | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40702.87
Organism:Homo sapiens (Human)
Description:P41146
Residue:370
Sequence:
MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50087016
NameBDBM50087016
Synonyms:8-Acenaphthen-1-yl-1-phenyl-1,3,8-triaza-spiro[4.5]decan-4-one | CHEMBL281274 | Ro65-6570
TypeSmall organic molecule
Emp. Form.C25H25N3O
Mol. Mass.383.4855
SMILESO=C1NCN(c2ccccc2)C11CCN(CC1)C1Cc2cccc3cccc1c23
Structure
n/a