Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyrotropin-releasing hormone receptor
LigandBDBM86214
Substrate/Competitorn/a
Ki 5400±n/a nM
CommentsPDSP_3209
Citation Lu, XBidaud, ILadram, AGershengorn, MC Pharmacological studies of thyrotropin-releasing hormone (TRH) receptors from Xenopus laevis: is xTRHR3 a TRH receptor? Endocrinology144:1842-6 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Thyrotropin-releasing hormone receptor
Name:Thyrotropin-releasing hormone receptor
Synonyms:TRH-R | Thyroliberin receptor | thyrotropin-releasing hormone R1
Type:Enzyme Catalytic Domain
Mol. Mass.:44568.52
Organism:MOUSE
Description:thyrotropin-releasing hormone R1 TRHR MOUSE::P21761
Residue:393
Sequence:
MENDTVSEMNQTELQPQAAVALEYQVVTILLVVIICGLGIVGNIMVVLVVMRTKHMRTPT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKNAVVVSCG
YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKMWKNDSIH
QNKNLNLNATNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKAANYSVALNYSVIKES
DRFSTELEDITVTDTYVSTTKVSFDDTCLASEN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86214
n/a
NameBDBM86214
Synonyms:CAS_32281 | NSC_32281 | Phe2TRH | TRH
TypeSmall organic molecule
Emp. Form.C16H22N6O4
Mol. Mass.362.3837
SMILESNC(=O)C1CCCN1C(=O)C(Cc1cnc[nH]1)NC(=O)C1CCC(=O)N1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: