Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor subunit alpha-2
LigandBDBM10759
Substrate/Competitorn/a
Ki 4.2±n/a nM
CommentsPDSP_229
Citation Jensen, AAMikkelsen, IFrølund, BBräuner-Osborne, HFalch, EKrogsgaard-Larsen, P Carbamoylcholine homologs: novel and potent agonists at neuronal nicotinic acetylcholine receptors. Mol Pharmacol64:865-75 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Neuronal acetylcholine receptor subunit alpha-2
Name:Neuronal acetylcholine receptor subunit alpha-2
Synonyms:Cholinergic, Nicotinic Alpha2Beta2 | Cholinergic, Nicotinic Alpha2Beta4
Type:Enzyme
Mol. Mass.:58597.25
Organism:Rattus norvegicus (Rat)
Description:P12389
Residue:511
Sequence:
MTLSHSALQFWTHLYLWCLLLVPAVLTQQGSHTHAEDRLFKHLFGGYNRWARPVPNTSDV
VIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNVTSLRVPSEMIWIP
DIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGS
WTYDKAKIDLEQMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRR
LPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSL
VIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRP
LPPMELHGSPDLKLSPSYHWLETNMDAGEREETEEEEEEEDENICVCAGLPDSSMGVLYG
HGGLHLRAMEPETKTPSQASEILLSPQIQKALEGVHYIADRLRSEDADSSVKEDWKYVAM
VVDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10759
NameBDBM10759
Synonyms:2-acetoxyethyl(trimethyl)ammonium;bromide | 2-acetoxyethyl(trimethyl)ammonium;perchlorate | CHEMBL667 | [2-(acetyloxy)ethyl]trimethylazanium | acetylcholine | acetylcholine chloride | cid_6060
TypeSmall Organic Molecule
Emp. Form.C7H16NO2
Mol. Mass.146.2069
SMILESCC(=O)OCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a