Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor
LigandBDBM50047021
Substrate/Competitorn/a
Ki 120±n/a nM
CommentsPDSP_1085
Citation Jensen, AAMikkelsen, IFrølund, BBräuner-Osborne, HFalch, EKrogsgaard-Larsen, P Carbamoylcholine homologs: novel and potent agonists at neuronal nicotinic acetylcholine receptors. Mol Pharmacol64:865-75 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Neuronal acetylcholine receptor
Name:Neuronal acetylcholine receptor
Synonyms:CHRNA4 | Cholinergic, Nicotinic Alpha4Beta2 | Cholinergic, Nicotinic Alpha4Beta4 | Neuronal acetylcholine receptor (alpha4beta2 nAChR) | Neuronal acetylcholine receptor protein alpha-4 subunit | Neuronal acetylcholine receptor subunit alpha 4 beta 2 | Neuronal acetylcholine receptor subunit alpha-4
Type:Enzyme
Mol. Mass.:70196.44
Organism:Rattus norvegicus (Rat)
Description:P09483
Residue:630
Sequence:
MANSGTGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVANI
SDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELI
WRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMK
FGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFI
IRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPS
PTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLF
MKRPSVVKDNCRRLIESMHKMANAPRFWPEPVGEPGILSDICNQGLSPAPTFCNPTDTAV
ETQPTCRSPPLEVPDLKTSEVEKASPCPSPGSCPPPKSSSGAPMLIKARSLSVQHVPSSQ
EAAEDGIRCRSRSIQYCVSQDGAASLADSKPTSSPTSLKARPSQLPVSDQASPCKCTCKE
PSPVSPVTVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAM
VIDRIFLWMFIIVCLLGTVGLFLPPWLAAC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50047021
n/a
NameBDBM50047021
Synonyms:2-(6-(2-hydroxy-2-phenylethyl)-1-methylpiperidin-2-yl)-1-phenylethanone | 2-[6-(2-Hydroxy-2-phenyl-ethyl)-1-methyl-piperidin-2-yl]-1-phenyl-ethanone | 2-[6-(2-Hydroxy-2-phenyl-ethyl)-1-methyl-piperidin-2-yl]-1-phenyl-ethanone (lobeline) | CHEMBL15476 | Lobeline | Lobeline, (-) | Lobeline,Alpha
TypeSmall organic molecule
Emp. Form.C22H27NO2
Mol. Mass.337.4553
SMILESCN1C(CC(O)c2ccccc2)CCCC1CC(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: