Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR4
LigandBDBM86441
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_3924
Citation Kimura, YHatanaka, KNaitou, YMaeno, KShimada, IKoakutsu, AWanibuchi, FYamaguchi, T Pharmacological profile of YM348, a novel, potent and orally active 5-HT2C receptor agonist. Eur J Pharmacol483:37-43 (2004) [PubMed]  Article
More Info.:Get all data from this article
 
HTR4
Name:HTR4
Synonyms:5-HT4 | Transducer protein htr4
Type:Enzyme Catalytic Domain
Mol. Mass.:81995.63
Organism:Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Description:5-HT4 HTR4 0::B0R470
Residue:778
Sequence:
MSIRSFAHRILRRALPGFVRRSYLAKFGVALLAVVVCISAAGGVMYLNTSEHLQQSSRTE
LKKAAELSSSAVDNWHDERTNNARMLAQYGVFDNDNATEVQQFFTDEQHHLPSDVRDIHY
VSLTDARVITSTDAGLRNASFGSEAAPWSRQQLTPGDDGVFVSQPYVNDGITEVAYVARV
SSTPGRRTAVVMTASLAAISSSFWDPTPHSFTQLVDGTGSVIADDSKRATRQPYVENATS
PIVGARAVGFQPAAQAAKEMDQAHETAYAPVDGTPWVVTLHVPTSEAYGLASNMAENVLL
ILGIALAGLVFIALTLGRGTVRALNDLEAKAAALERGEYDTDLDVARVDELGRLFEAFAS
LRDTVQARIRDANEQQVDAEAARSEAEAAQADAEAAQAEAEAAREESEAQARRLETTAEA
FSETMRAYAAGDLTVRLDADVEQAAMADIAAAFNEMAADMEATIADVVAFADEVATASTD
ASDSAAAVEQTGRDVSDAVGRIRDRAADQRDQLEAVASETDEMSATIEEVAASADQVAET
SQRAAALGDDGQAAAQDAVAQLEEIEDETQAAATAVDDLEAKMSEIETIVAAITDIAEQT
NMLALNANIEAARADQDGDGFAVVADEVKDLADESKASAAEIEALVAEVRAQTETSVAAM
DRIQERVSDGVETVSETERSLSEIAGRIAEADTGVQEISNAMDDQAASVSDVTTAVGDVA
ALGEETATEAESTADAAAEQATTLSDVAAQTETLAEHAVALREHAAQFEVAADNEPGA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86441
NameBDBM86441
Synonyms:CAS_3045225 | NSC_3045225 | YM348
TypeSmall organic molecule
Emp. Form.C14H17N3O
Mol. Mass.243.3043
SMILESCCc1cc2c(ccc3cnn(CC(C)N)c23)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a