Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor subunit alpha-2
LigandBDBM50026220
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_3246
Citation Xiao, YKellar, KJ The comparative pharmacology and up-regulation of rat neuronal nicotinic receptor subtype binding sites stably expressed in transfected mammalian cells. J Pharmacol Exp Ther310:98-107 (2004) [PubMed]  Article
More Info.:Get all data from this article
 
Neuronal acetylcholine receptor subunit alpha-2
Name:Neuronal acetylcholine receptor subunit alpha-2
Synonyms:Cholinergic, Nicotinic Alpha2Beta2 | Cholinergic, Nicotinic Alpha2Beta4
Type:Enzyme
Mol. Mass.:58597.25
Organism:Rattus norvegicus (Rat)
Description:P12389
Residue:511
Sequence:
MTLSHSALQFWTHLYLWCLLLVPAVLTQQGSHTHAEDRLFKHLFGGYNRWARPVPNTSDV
VIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNVTSLRVPSEMIWIP
DIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGS
WTYDKAKIDLEQMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRR
LPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSL
VIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRP
LPPMELHGSPDLKLSPSYHWLETNMDAGEREETEEEEEEEDENICVCAGLPDSSMGVLYG
HGGLHLRAMEPETKTPSQASEILLSPQIQKALEGVHYIADRLRSEDADSSVKEDWKYVAM
VVDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026220
NameBDBM50026220
Synonyms:2-hydroxy-N,N,N-trimethylethanaminium | CHEMBL282468 | CHEMBL293410 | CHEMBL920 | N-trimethylethanolamine | OXTRIPHYLLINE | choline | trimethylethanolamine
TypeSmall organic molecule
Emp. Form.C5H14NO
Mol. Mass.104.1702
SMILESC[N+](C)(C)CCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a