Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor
LigandBDBM50026220
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_3246
Citation Xiao, YKellar, KJ The comparative pharmacology and up-regulation of rat neuronal nicotinic receptor subtype binding sites stably expressed in transfected mammalian cells. J Pharmacol Exp Ther310:98-107 (2004) [PubMed]  Article
More Info.:Get all data from this article
 
Neuronal acetylcholine receptor
Name:Neuronal acetylcholine receptor
Synonyms:CHRNA4 | Cholinergic, Nicotinic Alpha4Beta2 | Cholinergic, Nicotinic Alpha4Beta4 | Neuronal acetylcholine receptor (alpha4beta2 nAChR) | Neuronal acetylcholine receptor protein alpha-4 subunit | Neuronal acetylcholine receptor subunit alpha 4 beta 2 | Neuronal acetylcholine receptor subunit alpha-4
Type:Enzyme
Mol. Mass.:70196.44
Organism:Rattus norvegicus (Rat)
Description:P09483
Residue:630
Sequence:
MANSGTGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVANI
SDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELI
WRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMK
FGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFI
IRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPS
PTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLF
MKRPSVVKDNCRRLIESMHKMANAPRFWPEPVGEPGILSDICNQGLSPAPTFCNPTDTAV
ETQPTCRSPPLEVPDLKTSEVEKASPCPSPGSCPPPKSSSGAPMLIKARSLSVQHVPSSQ
EAAEDGIRCRSRSIQYCVSQDGAASLADSKPTSSPTSLKARPSQLPVSDQASPCKCTCKE
PSPVSPVTVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAM
VIDRIFLWMFIIVCLLGTVGLFLPPWLAAC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50026220
NameBDBM50026220
Synonyms:2-hydroxy-N,N,N-trimethylethanaminium | CHEMBL282468 | CHEMBL293410 | CHEMBL920 | N-trimethylethanolamine | OXTRIPHYLLINE | choline | trimethylethanolamine
TypeSmall organic molecule
Emp. Form.C5H14NO
Mol. Mass.104.1702
SMILESC[N+](C)(C)CCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a