Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium-dependent dopamine transporter
LigandBDBM50047021
Substrate/Competitorn/a
Ki 5400±n/a nM
CommentsPDSP_1085
Citation Miller, DKCrooks, PAZheng, GGrinevich, VPNorrholm, SDDwoskin, LP Lobeline analogs with enhanced affinity and selectivity for plasmalemma and vesicular monoamine transporters. J Pharmacol Exp Ther310:1035-45 (2004) [PubMed]  Article
More Info.:Get all data from this article
 
Sodium-dependent dopamine transporter
Name:Monoamine transporters; serotonin & dopamine
Synonyms:DA transporter | DAT | Dopamine transporter (DAT) | Dopamine transporter protein (DAT) | Sodium-dependent dopamine transporter (DAT) | Solute carrier family 6 member 3
Type:Multi-pass membrane protein
Mol. Mass.:68497.11
Organism:Homo sapiens (human)
Description:Competition binding assay was determined using hDAT stably expressed in HEK293 cells.
Residue:620
Sequence:
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50047021
NameBDBM50047021
Synonyms:2-(6-(2-hydroxy-2-phenylethyl)-1-methylpiperidin-2-yl)-1-phenylethanone | 2-[6-(2-Hydroxy-2-phenyl-ethyl)-1-methyl-piperidin-2-yl]-1-phenyl-ethanone | 2-[6-(2-Hydroxy-2-phenyl-ethyl)-1-methyl-piperidin-2-yl]-1-phenyl-ethanone (lobeline) | CHEMBL15476 | Lobeline | Lobeline, (-) | Lobeline,Alpha
TypeSmall organic molecule
Emp. Form.C22H27NO2
Mol. Mass.337.4553
SMILESCN1C(CC(O)c2ccccc2)CCCC1CC(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a