Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 4C
LigandBDBM277715
Substrate/Competitorn/a
Meas. Tech.JMJD2C Assay
IC50<0.1±n/a nM
Citation Kanouni, TStafford, JAVeal, JMWallace, MB Histone demethylase inhibitors US Patent US10040779 Publication Date 8/7/2018
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 4C
Name:Lysine-specific demethylase 4C
Synonyms:GASC-1 protein | GASC1 | Gene amplified in squamous cell carcinoma 1 protein | JHDM3C | JMJD2C | JmjC domain-containing histone demethylation protein 3C | Jumonji domain-containing protein 2C | KDM4C | KIAA0780
Type:Protein
Mol. Mass.:119979.01
Organism:Homo sapiens (Human)
Description:Q9H3R0
Residue:1056
Sequence:
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVM
AVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGS
NIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGER
KRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQKRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM277715
NameBDBM277715
Synonyms:3-[(1,5-dimethyl-1H-indazol-3-yl)amino]pyridine-4-carboxylic acid | US10040779, Example 12 | US9617242, Example 12
TypeSmall organic molecule
Emp. Form.C15H14N4O2
Mol. Mass.282.2973
SMILESCc1ccc2n(C)nc(Nc3cnccc3C(O)=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a