Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNociceptin receptor
LigandBDBM86660
Substrate/Competitorn/a
Ki 0.021±n/a nM
CommentsPDSP_3923
Citation Carr&aagrovr;, GRizzi, AGuerrini, RBarnes, TAMcDonald, JHebbes, CPMela, FKenigs, VAMarzola, GRizzi, DGavioli, EZucchini, SRegoli, DMorari, MSalvadori, SRowbotham, DJLambert, DGKapusta, DRCalo', G [(pF)Phe4,Arg14,Lys15]N/OFQ-NH2 (UFP-102), a highly potent and selective agonist of the nociceptin/orphanin FQ receptor. J Pharmacol Exp Ther312:1114-23 (2005) [PubMed]  Article
More Info.:Get all data from this article
 
Nociceptin receptor
Name:Nociceptin receptor
Synonyms:KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OPIATE ORL-1 | OPRL1 protein | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40702.87
Organism:Homo sapiens (Human)
Description:P41146
Residue:370
Sequence:
MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86660
NameBDBM86660
Synonyms:OFQ/N UFP-102
TypeSmall organic molecule
Emp. Form.C73H123FN28O17
Mol. Mass.1683.9335
SMILES[#6]-[#6@@H](-[#8])-[#6@H](-[#7]-[#6](=O)-[#6@H](-[#6]-c1ccc(F)cc1)-[#7]-[#6](=O)-[#6]-[#7]-[#6](=O)-[#6]-[#7]-[#6](=O)-[#6]-[#7]-[#6]-c1ccccc1)-[#6](=O)-[#7]-[#6]-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#8])-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](-[#7])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a