Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM86761
Substrate/Competitorn/a
Ki 20±n/a nM
CommentsPDSP_1302
Citation Ohshita, KIshiyama, HOyanagi, KNakata, HKobayashi, J Synthesis of hybrid molecules of caffeine and eudistomin D and its effects on adenosine receptors. Bioorg Med Chem15:3235-40 (2007) [PubMed]  Article
More Info.:Get all data from this article
 
Adenosine receptor A3
Name:Adenosine receptor
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86761
NameBDBM86761
Synonyms:CAS_35920-39-9 | NECA | NSC_448222
TypeSmall organic molecule
Emp. Form.C12H16N6O4
Mol. Mass.308.2932
SMILESCCNC(=O)C1OC(C(O)C1O)n1cnc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a