Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target6-phosphogluconate dehydrogenase (6PGD)
LigandBDBM50043906
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
Ki 3144600±208100 nM
IC50 1410000±0.0 nM
Citation Bülbül, MErat, M Investigation of the effects of some sulfonamide derivatives on the activities of glucose-6-phosphate dehydrogenase, 6-phospho gluconate dehydrogenase and glutathione reductase from human erythrocytes. J Enzyme Inhib Med Chem23:418-23 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
6-phosphogluconate dehydrogenase (6PGD)
Name:6-phosphogluconate dehydrogenase (6PGD)
Synonyms:6-phosphogluconate dehydrogenase
Type:Protein
Mol. Mass.:53143.42
Organism:Homo sapiens (Human)
Description:P52209
Residue:483
Sequence:
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKE
MVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANIL
KFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQA
SKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSS
YNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50043906
NameBDBM50043906
Synonyms:CHEMBL269001 | Dorzolamide | MK-507 | US10172837, Dorzolamide
TypeSmall organic molecule
Emp. Form.C10H16N2O4S3
Mol. Mass.324.44
SMILESCCNC1CC(C)S(=O)(=O)c2sc(cc12)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a