BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target26S Proteasome regulatory subunit Rpn11 (Rpn11)
LigandBDBM88829
Substrate/Competitorn/a
Meas. Tech.Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay
IC50 5140±1040 nM
Citation PubChem, PC Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
26S Proteasome regulatory subunit Rpn11 (Rpn11)
Name:26S Proteasome regulatory subunit Rpn11 (Rpn11)
Synonyms:PSMD14 protein
Type:Protein
Mol. Mass.:34576.68
Organism:Homo sapiens (Human)
Description:O00487
Residue:310
Sequence:
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM88829
NameBDBM88829
Synonyms:4-[(E)-(1-butyl-2-benzimidazolyl)iminomethyl]-N,N-dimethylaniline | 4-[(E)-(1-butylbenzimidazol-2-yl)iminomethyl]-N,N-dimethyl-aniline | 4-[(E)-(1-butylbenzimidazol-2-yl)iminomethyl]-N,N-dimethylaniline | MLS000549030 | N-(1-butyl-1H-benzimidazol-2-yl)-N-[4-(dimethylamino)benzylidene]amine | SMR000113954 | [4-[(E)-(1-butylbenzimidazol-2-yl)iminomethyl]phenyl]-dimethyl-amine | cid_9634351
TypeSmall organic molecule
Emp. Form.C20H24N4
Mol. Mass.320.4314
SMILESCCCCn1c(\N=C\c2ccc(cc2)N(C)C)nc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a