BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target26S Proteasome regulatory subunit Rpn11 (Rpn11)
LigandBDBM88892
Substrate/Competitorn/a
Meas. Tech.Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay
IC50 658±96 nM
Citation PubChem, PC Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
26S Proteasome regulatory subunit Rpn11 (Rpn11)
Name:26S Proteasome regulatory subunit Rpn11 (Rpn11)
Synonyms:PSMD14 protein
Type:Protein
Mol. Mass.:34576.68
Organism:Homo sapiens (Human)
Description:O00487
Residue:310
Sequence:
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM88892
NameBDBM88892
Synonyms:MLS000401485 | N-(2-chlorophenyl)-2-[(2E)-2-[(2-morpholin-4-yl-4-phenyl-1,3-thiazol-5-yl)methylidene]hydrazinyl]-5-nitro-benzenesulfonamide | N-(2-chlorophenyl)-2-[(2E)-2-[(2-morpholin-4-yl-4-phenyl-1,3-thiazol-5-yl)methylidene]hydrazinyl]-5-nitrobenzenesulfonamide | N-(2-chlorophenyl)-2-[(2E)-2-[[2-(4-morpholinyl)-4-phenyl-5-thiazolyl]methylidene]hydrazinyl]-5-nitrobenzenesulfonamide | N-(2-chlorophenyl)-2-[(N'E)-N'-[(2-morpholino-4-phenyl-thiazol-5-yl)methylene]hydrazino]-5-nitro-benzenesulfonamide | SMR000243227 | cid_5993604
TypeSmall organic molecule
Emp. Form.C26H23ClN6O5S2
Mol. Mass.599.081
SMILES[O-][N+](=O)c1ccc(\[NH+]=N\[CH-]c2sc(nc2-c2ccccc2)N2CCOCC2)c(c1)S(=O)(=O)Nc1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a