BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target26S Proteasome regulatory subunit Rpn11 (Rpn11)
LigandBDBM52848
Substrate/Competitorn/a
Meas. Tech.Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay
IC50 4350±3420 nM
Citation PubChem, PC Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
26S Proteasome regulatory subunit Rpn11 (Rpn11)
Name:26S Proteasome regulatory subunit Rpn11 (Rpn11)
Synonyms:PSMD14 protein
Type:Protein
Mol. Mass.:34576.68
Organism:Homo sapiens (Human)
Description:O00487
Residue:310
Sequence:
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM52848
NameBDBM52848
Synonyms:MLS000333673 | Methanesulfonic acid 3-oxo-2-[1-(2,4,5-trimethoxy-phenyl)-meth-(Z)-ylidene]-2,3-dihydro-benzofuran-6-yl ester | SMR000437879 | [(2Z)-3-oxidanylidene-2-[(2,4,5-trimethoxyphenyl)methylidene]-1-benzofuran-6-yl] methanesulfonate | [(2Z)-3-oxo-2-[(2,4,5-trimethoxyphenyl)methylidene]-1-benzofuran-6-yl] methanesulfonate | cid_2002858 | methanesulfonic acid [(2Z)-3-keto-2-(2,4,5-trimethoxybenzylidene)coumaran-6-yl] ester | methanesulfonic acid [(2Z)-3-oxo-2-[(2,4,5-trimethoxyphenyl)methylidene]-6-benzofuranyl] ester
TypeSmall organic molecule
Emp. Form.C19H18O8S
Mol. Mass.406.406
SMILESCOc1cc(OC)c(\C=C2/Oc3cc(OS(C)(=O)=O)ccc3C2=O)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a