BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target26S Proteasome regulatory subunit Rpn11 (Rpn11)
LigandBDBM88993
Substrate/Competitorn/a
Meas. Tech.Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay
IC50 1330±155 nM
Citation PubChem, PC Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
26S Proteasome regulatory subunit Rpn11 (Rpn11)
Name:26S Proteasome regulatory subunit Rpn11 (Rpn11)
Synonyms:PSMD14 protein
Type:Protein
Mol. Mass.:34576.68
Organism:Homo sapiens (Human)
Description:O00487
Residue:310
Sequence:
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM88993
NameBDBM88993
Synonyms:MLS001304035 | SMR000718768 | cid_23703286 | sodium;(6R,7R)-7-[[(2Z)-2-(2-amino-1,3-thiazol-5-yl)-2-methoxyiminoacetyl]amino]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate | sodium;(6R,7R)-7-[[(2Z)-2-(2-amino-5-thiazolyl)-2-methoxyimino-1-oxoethyl]amino]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate | sodium;(6R,7R)-7-[[(2Z)-2-(2-aminothiazol-5-yl)-2-methyloximino-acetyl]amino]-8-keto-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate | sodium;(6R,7R)-7-[[(2Z)-2-(2-azanyl-1,3-thiazol-5-yl)-2-methoxyimino-ethanoyl]amino]-8-oxidanylidene-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate
TypeSmall organic molecule
Emp. Form.C13H12N5O5S2
Mol. Mass.382.395
SMILESCO\N=C(\C(=O)N[C@H]1[C@H]2SCC=C(N2C1=O)C([O-])=O)c1cnc(N)s1 |c:11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a