BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target26S Proteasome regulatory subunit Rpn11 (Rpn11)
LigandBDBM89017
Substrate/Competitorn/a
Meas. Tech.Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay
IC50 4690±511 nM
Citation PubChem, PC Dose response confirmation of uHTS RPN11 inhibitor hits in a Fluorescence Polarization assay PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
26S Proteasome regulatory subunit Rpn11 (Rpn11)
Name:26S Proteasome regulatory subunit Rpn11 (Rpn11)
Synonyms:PSMD14 protein
Type:Protein
Mol. Mass.:34576.68
Organism:Homo sapiens (Human)
Description:O00487
Residue:310
Sequence:
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM89017
NameBDBM89017
Synonyms:(4-aminophenyl)-diethyl-amine | 4-N,4-N-diethylbenzene-1,4-diamine | MLS002454419 | N,N-Diethyl-p-phenylenediamine | N4,N4-diethylbenzene-1,4-diamine | SMR001372013 | cid_7120
TypeSmall organic molecule
Emp. Form.C10H16N2
Mol. Mass.164.2474
SMILESCCN(CC)c1ccc(N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a