BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP-binding cassette sub-family B member 6, mitochondrial
LigandBDBM71445
Substrate/Competitorn/a
Meas. Tech.Dose Response of Flow Cytometric HTS Screen for inhibitors of the ABC transporter ABCB6 for Cherry Pick01
EC50 34690±n/a nM
Citation PubChem, PC Dose Response of Flow Cytometric HTS Screen for inhibitors of the ABC transporter ABCB6 for Cherry Pick01 PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
ATP-binding cassette sub-family B member 6, mitochondrial
Name:ATP-binding cassette sub-family B member 6, mitochondrial
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:93896.51
Organism:Homo sapiens (Human)
Description:gi_9955963
Residue:842
Sequence:
MVTVGNYCEAEGPVGPAWMQDGLSPCFFFTLVPSTRMALGTLALVLALPCRRRERPAGAD
SLSWGAGPRISPYVLQLLLATLQAALPLAGLAGRVGTARGAPLPSYLLLASVLESLAGAC
GLWLLVVERSQARQRLAMGIWIKFRHSPGLLLLWTVAFAAENLALVSWNSPQWWWARADL
GQQVQFSLWVLRYVVSGGLFVLGLWAPGLRPQSYTLQVHEEDQDVERSQVRSAAQQSTWR
DFGRKLRLLSGYLWPRGSPALQLVVLICLGLMGLERALNVLVPIFYRNIVNLLTEKAPWN
SLAWTVTSYVFLKFLQGGGTGSTGFVSNLRTFLWIRVQQFTSRRVELLIFSHLHELSLRW
HLGRRTGEVLRIADRGTSSVTGLLSYLVFNVIPTLADIIIGIIYFSMFFNAWFGLIVFLC
MSLYLTLTIVVTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI
IKYQGLEWKSSASLVLLNQTQNLVIGLGLLAGSLLCAYFVTEQKLQVGDYVLFGTYIIQL
YMPLNWFGTYYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYA
DGRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFRFYDISSGCIRIDGQDISQVTQA
SLRSHIGVVPQDTVLFNDTIADNIRYGRVTAGNDEVEAAAQAAGIHDAIMAFPEGYRTQV
GERGLKLSGGEKQRVAIARTILKAPGIILLDEATSALDTSNERAIQASLAKVCANRTTIV
VAHRLSTVVNADQILVIKDGCIVERGRHEALLSRGGVYADMWQLQQGQEETSEDTKPQTM
ER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM71445
NameBDBM71445
Synonyms:2-benzylsulfonyl-5-chloro-N-(4-methylphenyl)pyrimidine-4-carboxamide | 2-benzylsulfonyl-5-chloro-N-(p-tolyl)pyrimidine-4-carboxamide | 5-chloranyl-N-(4-methylphenyl)-2-(phenylmethyl)sulfonyl-pyrimidine-4-carboxamide | 5-chloro-N-(4-methylphenyl)-2-(phenylmethyl)sulfonyl-4-pyrimidinecarboxamide | MLS001116165 | SMR000625761 | cid_16446370
TypeSmall organic molecule
Emp. Form.C19H16ClN3O3S
Mol. Mass.401.867
SMILESCc1ccc(NC(=O)c2nc(ncc2Cl)S(=O)(=O)Cc2ccccc2)cc1
Structure
n/a