Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 1A (PDE1A)
LigandBDBM278973
Substrate/Competitorn/a
Meas. Tech.PDE1 Inhibition Assay
pH7.6±n/a
Temperature298.15±n/a K
IC50 0.800±n/a nM
Commentsextracted
Citation Kehler, JJuhl, KMarigo, MVital, PJJessing, MLanggård, MRasmussen, LKClementson, CM 1H-pyrazolo[4,3-b]pyridines as PDE1 inhibitors US Patent US10034861 Publication Date 7/31/2018
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 1A (PDE1A)
Name:Phosphodiesterase 1A (PDE1A)
Synonyms:Calmodulin-dependent phosphodiesterase | Phosphodiesterase 1 | Phosphodiesterase 1B (PDE1B)
Type:Protein
Mol. Mass.:61245.69
Organism:Homo sapiens (Human)
Description:P54750
Residue:535
Sequence:
MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGILRCLVKQLERGDVNVVDLKKNIEYAA
SVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTFTRKMGMTKKKPEEKPKFRS
IVHAVQAGIFVERMYRKTYHMVGLAYPAAVIVTLKDVDKWSFDVFALNEASGEHSLKFMI
YELFTRYDLINRFKIPVSCLITFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGI
MHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLM
QEEEMNILINLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSL
ILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGF
IDFIVEPTFSLLTDSTEKIVIPLIEEASKAETSSYVASSSTTIVGLHIADALRRSNTKGS
MSDGSYSPDYSLAAVDLKSFKNNLVDIIQQNKERWKELAAQEARTSSQKCEFIHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM278973
NameBDBM278973
Synonyms:5-(2-ethoxy-3-pyridyl)-1-isopropyl-3-methyl-N-[(5-methylisoxazol-3-yl)methyl]pyrazolo[4,3-b]pyridin-7-amine | US10034861, Example 3
TypeSmall organic molecule
Emp. Form.C22H26N6O2
Mol. Mass.406.4808
SMILESCCOc1ncccc1-c1cc(NCc2cc(C)on2)c2n(nc(C)c2n1)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a