Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 1C (PDE1C)
LigandBDBM279065
Substrate/Competitorn/a
Meas. Tech.PDE1 Inhibition Assay
pH7.6±n/a
Temperature298.15±n/a K
IC50 5.30±n/a nM
Commentsextracted
Citation Kehler, JJuhl, KMarigo, MVital, PJJessing, MLanggård, MRasmussen, LKClementson, CM 1H-pyrazolo[4,3-b]pyridines as PDE1 inhibitors US Patent US10034861 Publication Date 7/31/2018
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 1C (PDE1C)
Name:Phosphodiesterase 1C (PDE1C)
Synonyms:Phosphodiesterase 1 | Phosphodiesterase 1C | Phosphodiesterase, PDE1/PDE5
Type:Enzyme
Mol. Mass.:80778.58
Organism:Homo sapiens (Human)
Description:Q14123
Residue:709
Sequence:
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
SGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKAR
LAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGE
QQQNGDFKDGKNKTDKKDHSNIGNDSKKTDGTKQRSHGSPAPSTSSTCRLTLPVIKPPLR
HFKRPAYASSSYAPSVSKKTDEHPARYKMLDQRIKMKKIQNISHNWNRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM279065
NameBDBM279065
Synonyms:1-isopropyl-5-(2-methoxy-3-pyridyl)-N-[(6-methoxy-3-pyridyl)methyl]-3-methyl-pyrazolo[4,3-b]pyridin-7-amine | US10034861, Example 96
TypeSmall organic molecule
Emp. Form.C23H26N6O2
Mol. Mass.418.4915
SMILESCOc1ccc(CNc2cc(nc3c(C)nn(C(C)C)c23)-c2cccnc2OC)cn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a